SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_07826T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_07826T0
Domain Number 1 Region: 97-237
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-47
Family Ran-binding domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_07826T0
Sequence length 257
Comment | VDBG_07826 | Verticillium albo-atrum VaMs.102 ran-specific GTPase-activating protein (258 aa)
Sequence
MSAPEATEPKVEEPKIEAPKAEEAPATGTADAPATESTGEADKPVTAQSSVFSMFGGGAK
KEKKPEDEDRGDNSGSNKAQREAAAAAADDDQAPESEDVHFEPVHKLTEKVETATNEESE
QQLFKMRAKLFKFIKESSEWKERGTGDVRLLKHKENGKTRLVMRRDKTLKVCANHYIVPE
MKLSPNVGSDRSWVWNAAADVSEGEPEAATLAIRFANSENANLFKDAFLQAQKDNEALFK
KAEDGEASTETPAAEQS
Download sequence
Identical sequences C9SSF1
XP_003002367.1.67963 VDBG_07826T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]