SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_07986T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_07986T0
Domain Number 1 Region: 294-420
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000032
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  VDBG_07986T0
Domain Number - Region: 68-261
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00115
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_07986T0
Sequence length 494
Comment | VDBG_07986 | Verticillium albo-atrum VaMs.102 PH domain-containing protein (495 aa)
Sequence
MSATPTELPSRAATGLTTASTNDGAISDTDPTSTAGLLGERLQAWKHAVGYLEDYMGAIE
KIHRAQAKEYERALKTISNPLKEGHHFDQSLGGIAGYFENMRSNTQALINTNIETEKSIK
GSVLPVLDRLHKEIKAKSKELTSGVEKTAKEVEKARNNTQKHIELLGQQTASYESSGGKI
HGSDDPYVVNRGVLHRLHKQVIEENNNRNDLLAVQNNSQAFEAHIVQVIQQAMESFTLLA
GGQGEKTRALHYDMLQSIQSVVPDFEWRGFTTRSADRLINPNDPARSVDDIQFPNMSHPA
TKSLIEGSLERKSRNKLSWGYTTGYYVVTPSKFLHEFKDSDNARVDPKPELSIYLPDAII
GAPSGEKFNVKGKDRSGGMSAKLTGTAELAFKAHTPSDAQRWFDIIRGVAGATGPAEPTS
PSSPVVDQDAKFAAVTPPGPTSPVAGHEAQQSGVLAAADEKPPVQAAPAQAAPAQAAPAA
APAPEKAGAAPPAF
Download sequence
Identical sequences C9SSW1
XP_003001727.1.67963 VDBG_07986T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]