SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_08668T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_08668T0
Domain Number 1 Region: 232-469
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-82
Family SSRP1-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_08668T0
Sequence length 578
Comment | VDBG_08668 | Verticillium albo-atrum VaMs.102 FACT complex subunit pob-3 (579 aa)
Sequence
MAAIESFDSIFLDLSKSSGKCRFAETGLGWKPAGGGDTFTLDASAIASAQWSRAAKGYEI
KILSRDTRIIQLDGFPQDEFERLSKLFKNWYSTTLENKEHALRGWNWGKAEFGKAELSFN
VQNRPAFEVPYSEISNTNLAGRNEVAVEFAAPTDENDTGTNGTLDGARGKGKKAGAGKDQ
LVEMRFYIPGVAKKETDDDDAGSDAGGGQEEKNAVTLFYDTLMEKAEIGETAGDAIAQFL
DILHLTPRGRFDIDMYDTSFRLRGKTYDYKIQYEAIKKFMVLPKPDDAHVMLCVGLDPPL
RQGQTRYPFVVMQFKKDEEVTLDVNLTEEQIKEKYGDKLQSHYEQPLHQVITYIFRGLAN
KKVTTPAKDFQTHRNQLGIKCSIKASEGFLYCLEKAFMFIPKPATYIAYEQTASITFSRV
GGAVSALSTFDITVLMKNGAGSTQFSNISREDLKGLETFFKLKNLRVKNEIDEDANLLKA
ALREEAMDDSEDEVVGNKADRGSADEDEESVDEDFRADSESDVAEEYDSNPETSDSEDAE
SVVDNEEGGADADDDDDDDDEAGGDDDEERPKKKKKTA
Download sequence
Identical sequences C9SUU3
XP_003000872.1.67963 VDBG_08668T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]