SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_08890T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_08890T0
Domain Number 1 Region: 1282-1401
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000015
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_08890T0
Sequence length 1450
Comment | VDBG_08890 | Verticillium albo-atrum VaMs.102 INT1 (1451 aa)
Sequence
MENEEPKMALNQDSSPFQSSPLETASSPRLFWQNRNLNSISTDGLYGRSGSPSPTRRSSI
ERLQKASRVKNSNILALEQKLEYDPTRLPQIERPLAKVQGNAFGASGMSGLRSESDRSGF
THSRSDSKTSIPIYSPTSSPTKANAAAQSYFAPMSDADTTNPPRTPSKDQASPIKSSLST
TKFRSSVDQDNGFWSEDNSCDDRELPSGRALHRHATKSVTFDAAPPQINEYEMATPDISS
IGTNSREGSFESNEDEMEDHLHHRFGDHDAEDSFDASLEDTDKTPVVGPDDWRQSATRDD
DPFESSPMPEARPHQYASNRPAHLRTDSANSAGSDHRPLPPLPGQMTRRDSVQSSPGLSA
TAERMLGSPRSLPSPPPALASKSEIQNIGNGKMSLEERLKLMMLSDDVKSANEQQRERRL
RRGVQRDRLQSPTPDRESIASSMLEADEQDDTIGDLSGLGDYELPQRISRESILRRVNGN
QQSPGRDSEYQFSSPPPSSSPERGPDRRLAYDPDVPIPSTEDPGQDDAEMLDTEDSVIIH
RDVHSQDRDSEDRDDADGDYDSITDLYHRDDSRLTDRDDDEASQYSDDQRFNSKDPEVQE
VKVKEVQVVESDEEVTTPRAASPMDHNKVMSEAVLDHVEQKSVEVQQAAPEPLTDKPSEA
VVREEKAATSSGLPEFKSNDSENLFSKGLSTYMLPRPDEVTPQVEDLEPPPKMTDARAFL
QRPYTPDQLSKPEYDGSGWGEPDEEEFDEPGTPDSVIHHPVSDEEDLEEIVEEEEEAISP
VVPERQATIKASGSKLKTRPSATPSDIVSMRDARRQVSREVPEIPPIPERHRNRISRDFD
AEPEADTGDDFLERHPSFKKRSLTLDLDLGLSLDQDFERVIEAQKVAYAQEPLKAPSFTT
SSPSRQASKPPPSINTNPTETCMTNANVTSRRQRGYLMRQNTKLVTASDKQTDDYWMTKS
AGNSPVKKERPQTWTVEPWNSKPKQRSVRKRHGASGPVPPLPGQESNARLSGNTDDMNPE
LATEESGERGRLFVKVMGVKDLDLPIPRNERSWFSLTLDNGVHCVTTAWLELARNAPIGQ
EFELVVPNDLEFQLTLNVKLEKPAAPKKVIQSSPTKVTKPKTSTFSRVFASPKKRKEMEL
RHREEEERQAAQQREAAQARQIKAAPTSYDLLSPLAAEDGSFARSYVCLKEHESRCYGRP
YLAEVACFNEWATEEAGFASSVKSKRGNTAVVRKAPYKIGNLELQLLFVPRPKGATDEDM
PKSMNSCIRELKAAEERLSRNWEGNLSQQGGDCPYWRRRYFKLVGTKLTAYHESTRQPRA
TINLSNAKRLIDDRRALVEKETLGKGGRRRRSAFAEEEEGYMFVEEGFRIRFNNGEVIDF
YADTAADKEGWMKALSDVVGRGESGSDDDVNRSKLKGKWCDLILKREEAIKKRAASGGRR
THSRTKSTYN
Download sequence
Identical sequences C9SVG5
VDBG_08890T0 XP_003001094.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]