SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_08934T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_08934T0
Domain Number 1 Region: 363-535
Classification Level Classification E-value
Superfamily vWA-like 6.23e-22
Family Integrin A (or I) domain 0.029
Further Details:      
 
Domain Number 2 Region: 164-292
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000493
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDBG_08934T0
Sequence length 872
Comment | VDBG_08934 | Verticillium albo-atrum VaMs.102 von Willebrand and RING finger domain-containing protein (873 aa)
Sequence
MFSRHKTPKGHSAGASTYDDHTRGTQSTLLELGLVSPKSVRDPQRSKYSAGGVNPYDSDV
PTFPEKGHSIAAGTVRGHRGHRHTASSGSARSTDSNSKTVRSSHDHGDQHRPTRQPPISA
QRRPVLTNAKIEDAFARPPSPARSAPRFYPYESPEVLEEITESLRNRVDNWHGLDFSRFG
KLRLYGTLRVGKDKLSWQELECFLFAEMLICVKEKKVILANQWDENGLPKKSTRCTLKGS
ILIKKHLNEVTETGNIDENVLTLSLSVAELPQFHLRFENRNQLKLWQQALLDLNAVETSP
IRSPEYDRGDLSEVEEEDWQRSRPQRVSSVASSWGGAKSATTAPTEYTNFQRSPGLPALV
HVPIDVVVVVPISSSMQGVKINLVRDALKFMINTLGDRDRMGLVTFGSGGGGVPLVGMTT
KAWPGWNNILSAIKPIGQKSHRADVVEGANVAMDLLMQRKHNNPIATIMLISDASTSDAD
SVDFVVSRAEAAKITIHSFGLGMTHKPDTMIELSSRTKASYTYVKDWMMLRECLAGCLGA
MQTLSHQNVKLKLKLPEGSPAKFHKISGALQITKRATGRDAEAALGDLRFGDKRDILVQL
VILPDNASQEQLPQDPWDNIVSGLEALGGSGESDEQRVASVEEVPLIQADLTWGDILRDG
TLSHMPRPTLLAITMLPAQAKAKNSWSGSPPIPPHPGIVQRRMELLTSDMLTRALTLVSR
GQHDRAHTLLNETRSILKGLGKGGLPPVPSLPPNKSLPSTPHPGHDGSPTTGTPDPQAHT
FPYPIYHLLRHGSLPGAWHWPQPLTRRPQSQHWHRRQHRGCLDAELESSLEWISHPAVFG
RDSRKAVLQAYWRHQLTTRLYFPNADRVHLVW
Download sequence
Identical sequences C9SVK9
VDBG_08934T0 XP_003001138.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]