SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_09512T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_09512T0
Domain Number 1 Region: 63-209
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-25
Family Dcp1 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDBG_09512T0
Sequence length 276
Comment | VDBG_09512 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (277 aa)
Sequence
MVNQTPRGKRGGGHARHSSASHRHANPVTSDYDSDAPAHALLDQNAAAPAPNPALLNRTN
TDLNLAVLRRHIPAIHSILSIAANAVVYTFAPATSSWERAGIEGTYFLCFLAPDAGPAQD
PSIAAAAAAAPPRACIFVLNRRGLNNVSIDLASVGHFEVMDGIYIFRLDEGTDVLAGVKP
EGDAADAAIDTTVVGIWIHTEDDETRMSNAVMVQETLRLVQTGEAHVEDDAVQAQGQGQG
QGQEQEYVPPAAAAQPTGRKLSVSALFGVAPNGLSG
Download sequence
Identical sequences C9SXL2
XP_003000317.1.67963 VDBG_09512T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]