SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_09807T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_09807T0
Domain Number 1 Region: 955-1369
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.6e-95
Family Gtf glycosyltransferase 0.0017
Further Details:      
 
Domain Number 2 Region: 277-423
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-28
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDBG_09807T0
Sequence length 1392
Comment | VDBG_09807 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (1393 aa)
Sequence
MAPTHPSLPAISTALSPTTASPNSAQPTPTPTDEDPKRRVARKLRRKRRNETYAMDLPER
LKGGNDSEDEEDLMPAGNTQNGPPMFMNMNQSIFGLIAAAGSRVDFHDRFEGQSSDDDDE
SGHQTTKPDKHTATSPEPESNPVQNDRHGPKRLRNAVIVGPARQATSLPALFRLCLASGN
GGPRKNRQSWSPPSEDASESSVPQSSLHESAEEDQDQYKLAPVMSRMLEARADVASRPSF
DLDRLTSEHSRRDSSDLGPSPLALRLAEIFEFTKPEEVIEEYPCWLLQSVLLQGYMYITA
RHICFYAYLPKKATQHEVVKSGYLSKSGKRNPKYNRYWFRMKGDVLTYYRDPSNVYFPSG
QIDLRYGISASITDKDKAGLHFSVTTSHRTYHFRADSAPSAKEWVKSLQRVIFRSHNDGD
SVKISMPIENVIDIEDSQMLQFADTCKIRVIDNDETYAIDEYFFSFFSFGKEAINVLKIM
FEGASAETKDPADLPKGASARTSIAANRRSIGPDKIGIARLPENVKATLSPMSPTSPLGP
SPRPSADVARPSMDAFRVFGRKSLDLSSVTRDASPRRSFSGSRSHSRNRLEDSRNTVDKN
ESSDSYVQSSMEDPSFSAMAASSNEDASASQILHRSDVFQSPTMRRSGSRTRQSSKKTVQ
GTQSPPALATYSGQHAATTGSIADDPNKGPSLQSITKMGAYPLQRVGAFAEYLNSSSRRM
SSMLATESMGYVEKVSGMWKGNRKHYDAPPETRTDDEDLYEDSEGRVQLSTERFRAHFAL
PETEKLQVTYYGFLFQVLPLYGKIYISDRFLCFRSLLPGTRTKLILPLKDIENVDKEKGF
RFGYSGLVLVIRGHEEVFFEFSQRDAREDCFGHLLKSVERSRFLHNSGMLNREDKEDAEY
ALAEREALKEARQDEFHDHEVKLPEQTSCLSDAPTILFDDPKASFLNFKPAQSLKVTCLT
IGSRGDVQPYIALCKGLIAEGHRPRIATHAEFQPWVESHGIEFAKVEGDPGELMRLCIEN
GTFTFSFIREANSMFRGWLDELLVSAWEACQGSDLLIESPSAMAGIHVAEALGIPYFRAF
TMPWTRTRAYPHAFVVPESKLGGAYNYMTYIMFDNIFWKATAGQVNRWRNKTLKLPNTNL
EKMQPNKVPFLYNFSPSVVAPPLDFSDWIRVTGYWFLDEATKWEPPKELTDFIAQARADD
KKLVYVGFGSIIVNDTAKMTQEVIDAVLKADVRCILSKGWSDRVASSGDAGTDDAAATSK
REEPVMPPEIHVIKSAPHDWLFSQIDAAAHHGGSGTTGASLRAGIPTIIRPFFGDQFFFG
NRVEDIGLRACSVEATHNERMIIKARVLGEQIRKENGVESAIQCISRDMEYATSLVKRKG
DKNRKGSPRPAG
Download sequence
Identical sequences C9SY32
XP_003000087.1.67963 VDBG_09807T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]