SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59713272|ref|YP_206047.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713272|ref|YP_206047.1|
Domain Number 1 Region: 66-234
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.36e-17
Family Thioesterases 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59713272|ref|YP_206047.1|
Sequence length 323
Comment hydrolase/lipase [Vibrio fischeri ES114]
Sequence
MKQKDFFLYAVMSVFLGMQGCASSSDIKQNVGTSEIAHTKQTLQIAGLKHCNNEGNDSIH
LNPDEPLTIIVHGCFSSAGRFETLADVYGLYDQQAICFEYDDRKSLEDTSGELVAALNQL
STQNPNQDLHVIGHSQGGLVARRALTSEREDQQTVTAKKVQLTTVSSPFNGIEISSHCGI
TPLRILSLGIVDLICYAVTGEKYQQIPPNADFIEQPGDLVASVSQHLVIKTDERNSCRKE
NDKGECIEDDYVFSVNEQSNNQVDDGVNTDLVTVKAGHVEIVGNGESVPTDLINILKQKE
VLVDKSGVDEQKQGYLINQLYFD
Download sequence
Identical sequences Q5E1D7
WP_011262990.1.76652 YP_206047.1.56684 APC61224 312309.VF_A0089 gi|59713272|ref|YP_206047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]