SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59714105|ref|YP_206880.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714105|ref|YP_206880.1|
Domain Number 1 Region: 12-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.04e-24
Family Thioesterases 0.00000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59714105|ref|YP_206880.1|
Sequence length 307
Comment acyl transferase [Vibrio fischeri ES114]
Sequence
MKDESSFFTIDHIIELENGQSIRVWETPPKSDTHKKNSTIVIAAGFARRMDHFAGLAEYL
SSNGFRVIRYDSLHHVGLSSGQIDEFSMSIGKHSLLIVVGWLRAKGIQNLGIIAASLSAR
IAYEVINDIDASFLITAVGVVNLQDTLEKALKYDYLRLPIDELPDDLDFEGHNLGSKVFV
TDCLKNEWDTLGSTFKAVQGLNIPFIAFTANGDSWVNQSDVEKMIDNIDTTQCKLYSLIG
SSHDLGENLVVLRNFYESVTRAAVALDKGSLDLDIEIVEPGFEDLTSTTVKERRLRNKIE
NELLELA
Download sequence
Identical sequences Q5DZ04
WP_011263742.1.11820 WP_011263742.1.34959 WP_011263742.1.76652 YP_206880.1.56684 gi|59714105|ref|YP_206880.1| 312309.VF_A0922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]