SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414087934|ref|YP_006988117.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414087934|ref|YP_006988117.1|
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000311
Family DNA polymerase I 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414087934|ref|YP_006988117.1|
Sequence length 81
Comment putative Pol I DNA polymerase, palm domain [Caulobacter phage phiCbK]
Sequence
MGERLSKSEPPIQNIPIRTEAGRQIKDGFLQQMRAAEQAMAKIDFAEIEARILAELGPGY
EASFDGRVHDEFSYTVRKVEP
Download sequence
Identical sequences A0A1V0EA29 A0A1V0EB17 A0A1V0ED02 A0A1V0EE49 A0A1V0EEZ3 J3UI84 K4JTH5 K4JTU7 K4JUG0
YP_006988117.1.40103 YP_006988910.1.28434 YP_006989613.1.47547 gi|414087934|ref|YP_006988117.1| gi|414088737|ref|YP_006988910.1| gi|414089461|ref|YP_006989613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]