SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13242620|ref|NP_077634.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13242620|ref|NP_077634.1|
Domain Number 1 Region: 175-297
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000209
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 2 Region: 52-85
Classification Level Classification E-value
Superfamily F-box domain 0.0000876
Family F-box domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13242620|ref|NP_077634.1|
Sequence length 320
Comment EsV-1-149 [Ectocarpus siliculosus virus 1]
Sequence
MRSSCCFFNRRFMLTRGPSINIWLHATYFSQEFVVSSGTSKPTPGVLTTMPRLLPKDTLQ
HILSFVKEDSFAIIGSVCRDFRNCYGSGERVTRTSKYTQSLRLFQQATAKNIEFKSLGLL
DDLISRDEIDVIPSLLARGYEWDHFCVQRAAETNNYKFFQWLQTTDDLPWLVENAHRAAA
KEGNLEMMIYLVDSGAGFPDSGSRAVTNDCKIVEWLRELQLDPAHAFVRAAREDDVCVFE
QTESFDDHGLNRACVREACVHGAFNVLEFFRVFVDVGPTVSDVAAALHFQTVDILDWCRE
FFPCLVEELSGMRLRLRSAL
Download sequence
Identical sequences Q8QND3
Q8QND3_ESV1 NP_077634.1.71218 gi|13242620|ref|NP_077634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]