SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|422936952|ref|YP_007007217.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|422936952|ref|YP_007007217.1|
Domain Number 1 Region: 134-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000038
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|422936952|ref|YP_007007217.1|
Domain Number - Region: 182-211
Classification Level Classification E-value
Superfamily WW domain 0.00868
Family WW domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|422936952|ref|YP_007007217.1|
Sequence length 371
Comment hypothetical protein RaK2_00062 [Enterobacteria phage vB_KleM-RaK2]
Sequence
MTISFNNGSNCSCNNSGIKSMKISTDGHLIVTYADNTIEDLGLVVGHDGSDGSNFYPNEI
GFEIPDSDFNTDKTIGWSYLSLANSTSVLYFKTSNPGESSTWNSVEFGKGEQGEQGKPFH
IDSSGTVFPTSGLFDGYTFYNTNDGKLYFYDSSTQTWSSGISFRGEVGPRGRFHIDSTGS
TFPDITNLPEDYCFYNTSDGKLYYVDIVENTDPVQKEWSTGIEFRGKEGLQGEKGDKGDA
GKDIVVIVNTIDHSYTNTVLVIGTCPAGYLVTNIEVNVTQGYEPPVTDMKIRFSGEANED
IGGTVIAGYDYFDISMQSRYVINETNHTVSDKDEIISCIFNESVNLSSYGNMTIICTLSW
QAPTLPISDNI
Download sequence
Identical sequences H6X3L9
gi|422936952|ref|YP_007007217.1| YP_007007217.1.100461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]