SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531035803|ref|YP_008437437.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531035803|ref|YP_008437437.1|
Domain Number 1 Region: 103-205
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000811
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 2 Region: 15-89
Classification Level Classification E-value
Superfamily F-box domain 0.0000000183
Family F-box domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|531035803|ref|YP_008437437.1|
Sequence length 276
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
MQTWACTDGVHAPTQITDLPDEILQHILSFLTCAWRAVGPLGVCTRWRRIVLDPASPWRG
QCTKFHTRRRARRCATAARHGHLACLVEMHERGYAWRANVSANAARGGHLDCLRYAHESG
CDWDERTCAEAASGGHLACLTYARENGCPWDQRVTASAAAGGYIACLRYAIDGGRPAGAR
AACKAIAGGHLDCLIYLHENGCCWNPDIFYEAVAHDQLACLTYMCETPNSWLDGMRNKVI
YRRRYDPRWWADKDTIVVILDHPTSSCAAYLRAYLC
Download sequence
Identical sequences S4VY26
YP_008437437.1.94284 gi|531035803|ref|YP_008437437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]