SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531035859|ref|YP_008437493.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531035859|ref|YP_008437493.1|
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily F-box domain 0.0000000458
Family F-box domain 0.0028
Further Details:      
 
Domain Number 2 Region: 100-180
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|531035859|ref|YP_008437493.1|
Sequence length 291
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
MELGRRGDEHPTIPSAIAATIDDLPDELLQHILSFMTCARRAVGPIAVCTRWRRAVLDPS
SPWSGQCTVFYMRRRARRCETAALHGHLACLVEMRQKGCAWNAKVCANAARGGHIECLVY
AHENACPWDERTPAQAAAGGHMACLAYAHEHGCPWDRFTTANAAAAGHLQCLRYAADRDC
PLGPHVARKATVGGHPDSLALVYESGCRWTPDFFFKAIAHERLACLAYLFESCPMRVPLH
LCSTPSCCLATVRERVAPLLKASRSPCASFARERLSQLPPLTRFYETNGLQ
Download sequence
Identical sequences S4W1V9
gi|531035859|ref|YP_008437493.1| YP_008437493.1.94284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]