SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531036009|ref|YP_008437644.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531036009|ref|YP_008437644.1|
Domain Number 1 Region: 224-318
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000379
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number 2 Region: 20-60
Classification Level Classification E-value
Superfamily F-box domain 0.000000419
Family F-box domain 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|531036009|ref|YP_008437644.1|
Domain Number - Region: 140-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0104
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|531036009|ref|YP_008437644.1|
Sequence length 341
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
METAHRARARATCRRELEPSNDRLPNEILGLVFGRLECVDRRVRAAAVCRTWRLVALDDA
AVGRHSCIRKEPSCSKTAAFHAAKSAAKAGHVDCARRIFGPHPAIDDPFDEIPRAAARSD
DVDHFAWIVGQCRTDMRCVITDAASYGASRVLAHILLNEGSWLRSHHAFRGMKKAIKNGH
VDCVRMLAPYCRGRDDPIAAVVARGTPAMVGLLVDAGHRLHEGACATAASWGRLDMLCYL
RSIGCPWNAVTCAWAIKSRRLDILAYARNNGCPWDAQSCAAAVTTGQHQLLDQLRSVDCP
WDATVCAAAAERGDLDALVRLHQAGCPMDSAVRARRRQWPP
Download sequence
Identical sequences S4W297
gi|531036009|ref|YP_008437644.1| YP_008437644.1.94284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]