SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531036261|ref|YP_008437897.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531036261|ref|YP_008437897.1|
Domain Number 1 Region: 3-43
Classification Level Classification E-value
Superfamily F-box domain 0.0000131
Family F-box domain 0.0052
Further Details:      
 
Domain Number 2 Region: 75-123,154-184
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000034
Family Pseudo ankyrin repeat 0.022
Further Details:      
 
Weak hits

Sequence:  gi|531036261|ref|YP_008437897.1|
Domain Number - Region: 188-252
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00017
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|531036261|ref|YP_008437897.1|
Sequence length 260
Comment hypothetical protein ps_1486 [Pandoravirus salinus]
Sequence
MDTPIEALPEELIARILAAVPCIVRARDCTRVCSLWHRLAGDRAAMGGGPCVTAGWRTRH
AKEVDMEHHRMSLVDHAAAAGHIHCLDYAEACQPEPKLSVACLLAAYYGRSETLTWLAAR
DVRSIPTVYMRLSEMAIRGGNPICLDIALSLDVAFDRERACAMAAAAGHADMLVHLRTKG
CAWTDDVCRQSADHDRVECLAYAHRSGLSLDACGVRHAIRWHRNDIARYLWTHKHPPTRR
CMDVAGRSGNVECFAHARRV
Download sequence
Identical sequences S4VVZ6
YP_008437897.1.94284 gi|531036261|ref|YP_008437897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]