SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531036305|ref|YP_008437942.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531036305|ref|YP_008437942.1|
Domain Number 1 Region: 117-253
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000379
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 2 Region: 14-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000196
Family F-box domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|531036305|ref|YP_008437942.1|
Sequence length 314
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
MSISRTKLARPHHGITPNVSQSPRGPKSLDDLPDEVLATIGRRLDCMAVYSTMPRVSRRW
RAIVSDRALLGPSLCIKKHSDKAHTKEKKYLYAHAPTCPRRRLACADAIRAGAAPSMLFR
LQKLGHKFNKDAIMAAILADDLMSLRVLRTSKTYAVEADHYNAAALHGRTDVLAYFVANE
GSNWRNANVAIVAARYGHLDCLKLAHQSGIKWDVKVAVAAARGGHVDCLAYARDYGCPWD
PRALYAEAKSNNREACCEYIARHTTERLTERFADESRKALALVVLVVPATVLFLVAIFFF
GVSCAHLFAHKDGQ
Download sequence
Identical sequences S4VWW5
YP_008437942.1.94284 gi|531036305|ref|YP_008437942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]