SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531037133|ref|YP_008438775.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531037133|ref|YP_008438775.1|
Domain Number 1 Region: 91-218
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000017
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000109
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|531037133|ref|YP_008438775.1|
Sequence length 323
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
MTIDALPDEIIAHIFSFLPCIDLAARVRPVCRRWLAIASDPLAVGPNCARLRYSSCLHQH
RPSLGVRAATFGHIHCLADARERGCQWGPDLCVAAAANGRLAALVWLRRQGCPWDDDVCR
GAASRGHVECLAFAHEKGRSLARCDWKKAVHRGDIGVVEYGCKHGWAPKKRMLRIAVARD
HVDMVRCLLAYGCPWDPDCLCRIAIDSGSLNCIDYLHERDRLCGMSLGPCAIKARRPDVI
AYIESQGQSCDKRHNVVRAGTGATIGSGRRHVAAKHGPLTILADNHKTMQPGGVSKKGHN
RGARERDKKEPPTFDAPFLHGSW
Download sequence
Identical sequences S4W1L2
gi|531037133|ref|YP_008438775.1| YP_008438775.1.94284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]