SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|531037174|ref|YP_008438816.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|531037174|ref|YP_008438816.1|
Domain Number 1 Region: 168-248
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000111
Family Pseudo ankyrin repeat 0.031
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily F-box domain 0.00000262
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|531037174|ref|YP_008438816.1|
Sequence length 327
Comment ankyrin repeat [Pandoravirus salinus]
Sequence
MAHPAMAPCAVDSLPTEILDVVLARYLDNTGRMAAAQVCHRWHDVISAAAARQSPIDNMP
CRANSNRRSFFKRGLTTNSVAILQWLGGTKEARDGLMTTSCGHAHCEYDADVLRDRAFET
AAGAGSSRALAWLFANWIAYAARPHEATFSDWHLTAQRGRSPACAVAFVAARCDHIDTVQ
WLWRHLGPDPVHLSVLRCGLAAAIFCDNRSILEWLIQQHHRSNAESLDKSLVTAARLNRK
RCVAALLSARCIGRIADAFVVAVCEDNETTEQLIAEAMRRDDVKPAVVRQIERYGRARTL
AFEALGGRWESIKTRHKRRILDFLEDF
Download sequence
Identical sequences S4W4T1
gi|531037174|ref|YP_008438816.1| YP_008438816.1.94284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]