SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384438889|ref|YP_005653613.1| from Thermus sp. CCB_US3_UF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384438889|ref|YP_005653613.1|
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.7e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.000000714
Further Details:      
 
Domain Number 2 Region: 3-50,173-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.5e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000128
Further Details:      
 
Domain Number 3 Region: 254-316
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000000000000249
Family C-terminal domain of RNA polymerase alpha subunit 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384438889|ref|YP_005653613.1|
Sequence length 317
Comment DNA-directed RNA polymerase subunit alpha [Thermus sp. CCB_US3_UF1]
Sequence
MFESKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIED
VLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMQTTTLVLRAEGPKEVKAADFTVPSDV
ELLNPDLHIATLEAGGRLYMEVRVDRGVGYVPAERHGTKDRINSIPVDAVFSPVRRVAFQ
VEDTRLGQRTDLDKLTLRIWTDGSVTPMEALNQAVEILKEHLSYFANPQTTALPTPEPAV
GERPERGGEKEEDLDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERS
LEEIREALAKRGFALKE
Download sequence
Identical sequences G8N9P1
WP_014514899.1.31984 gi|384438889|ref|YP_005653613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]