SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000068 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000068
Domain Number 1 Region: 48-309
Classification Level Classification E-value
Superfamily L domain-like 2.27e-39
Family Ngr ectodomain-like 0.0064
Further Details:      
 
Domain Number 2 Region: 428-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000398
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 520-610
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000252
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000068   Gene: ENSPCAG00000000074   Transcript: ENSPCAT00000000073
Sequence length 702
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6069:42281:44701:1 gene:ENSPCAG00000000074 transcript:ENSPCAT00000000073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDMPLQIHVLLGLAITTLAVDKKVGCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGLLS
FPARLPADTQILLLQTNNIAKIEYALDFPVNLTGLDLSQNNLSSVTHINIKKMPQLLSVY
LEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSK
WFEALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALDGLENLESIS
FYDNRLIKVPHVALKVINLKFLDLNNPINRIRTGDFSNMLHLKELGINNMPDLISIDSLA
VDLPDLRKIATNNPRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEAGDYVSLHCRATADLQPEIYWITPSGQKLLPNTLTEKFYVHSEGTLDISAI
TPKEGGLYTCIATNLVGADLKSVMIKVDGSFPQERNGSLNIKIQDVQANSILLSWKASSK
ILKSSVKWTAFKKTENSHAAQTARIPSDVKVYNLTHLNPSTEYKICVDIPTIYQKSRKQC
VNVTTKGLDPNKKEHKKSNSAAFIACLAGLLGITGVICLVNSAFQDMNNGDGHSDAGNYV
QKPTSAFSELYPPLINLWETGQEKGTALEVKATVIGVPTNLS
Download sequence
Identical sequences ENSPCAP00000000068 ENSPCAP00000000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]