SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000168 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000168
Domain Number 1 Region: 28-302
Classification Level Classification E-value
Superfamily L domain-like 2.93e-61
Family Ngr ectodomain-like 0.000000000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000168   Gene: ENSPCAG00000000192   Transcript: ENSPCAT00000000179
Sequence length 473
Comment pep:known_by_projection scaffold:proCap1:scaffold_8384:12965:40241:1 gene:ENSPCAG00000000192 transcript:ENSPCAT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAFAEGSQLLAWLLWLQAWQVAAPCPGACVCYSEPKVTTSCPQQGLLALPTDIPAASQ
RVFLHGNHITHVPAAGFHACRNLTILWLHSNALARIDAAAFAGLALLEQLDLSDNAQLRF
VDPATFRGLSRLHTLHLDRCGLQELGPGLFHGLVALQYLYLQDNGLQALPDDTFRDLGNL
THLFLHGNRIPSVPERALRGLHSLDRLLLHQNRVAHVHPHAFHDLGRLMTLYLFANNLSA
LSAEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQQFRGSSSELLCTLPPRLAGRDLKR
LAAADLEGCAMAARPSRPIRTGGLTDEELLGLPKCCQPDVMDKASVLEAGSPASAGNALK
GRVPPGDGPPGNGSSPRHNNDSPFGTLPGSAEPPLTGLQPEGPEPPGPPTTGPRRRPGCS
RKNRTRSQCRLGQAVGGGGGSGDAEGSGALSSLACSLAPLGLALALWTVLGPC
Download sequence
Identical sequences ENSPCAP00000000168 ENSPCAP00000000168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]