SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000215 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000215
Domain Number 1 Region: 253-497
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-69
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 163-259
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-20
Family Hepsin, N-terminal domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000000215
Domain Number - Region: 142-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000215   Gene: ENSPCAG00000000231   Transcript: ENSPCAT00000000232
Sequence length 505
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3486:5165:40821:-1 gene:ENSPCAG00000000231 transcript:ENSPCAT00000000232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGSHLDASLARISSSRAFPAQVPPAAVSPARTSPSRLLPGRSSGRSASNTVSPTRVYL
VRATPVGAVPTRASPARSSSATRATVESSGLSLSKFTWQEGQKRLPLIGCILLLIALVVS
LILLFYFWRGHIGIKYKEPVESCPKHTVHCDGVVDCKLKSDELGCVRFEWDKSLLKVYSG
TSHKWLPICSDNWNDTYSERICQQLGFESAYRTTEVAHRDFTNSFSISQYNSTIQESLYR
SECPSQHYVSLQCSHCGLRAMTGRIVGGMLASENKWPWQVSLHYRTTHICGGTLIDAQWV
LTAAHCFFVTQEKMLDGWKVYAGTSNLHQLPEAASISQIIINGNYTDEQDDYDIALMRLS
KPLTLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTSPFLREVQVNLIDFKKCN
DYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAVTSWGTGCGQRNKPG
VYTKVTEVLPWIYSKMESEVRFQKS
Download sequence
Identical sequences ENSPCAP00000000215 ENSPCAP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]