SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000293 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000293
Domain Number 1 Region: 50-189
Classification Level Classification E-value
Superfamily L domain-like 0.000000000253
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 243-523
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.00000549
Family Putative isomerase YbhE 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000293   Gene: ENSPCAG00000000323   Transcript: ENSPCAT00000000316
Sequence length 531
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4523:4276:43979:-1 gene:ENSPCAG00000000323 transcript:ENSPCAT00000000316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLSAACLIPPSAQVRRLARCPATCSCTKESIICVGSSWVPRIVPGDISSLSLVNGTF
LEIKDRMFSHLPSLQLLXXXXXXXXXXXXXXXXXXXXXXXXFIEGNKIETISRNAFRGLR
DLTHLXXXXXXXXXXXXXXXXXXXXXXXXDLRGNKFECDCKAKWLYLWLKMTNSTVSDVL
CIGPPEYQDRKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMEN
CMVLEWDHIEMNFRSYDNITGQSIVGCKALIDDQVFVVVAQLFGGSHIYKYDESWTKFVK
FQDIEVSRISKPNDIELFQIEDEKFFVIADSSKAGLSTVYKWNSKGFYSYQSLHEWFRDT
DAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDVLAVKSFRMQNSLYL
SLTRFIGDSRVMRWNNKQFVEIQALPSRGAMTLQPFSFKENHYLALGSDYTFSQIYQWDK
EKQLFVKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL
Download sequence
Identical sequences ENSPCAP00000000293 ENSPCAP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]