SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000458 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000458
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000148
Family Fibronectin type III 0.011
Further Details:      
 
Domain Number 2 Region: 125-177
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000032
Family Fibronectin type III 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000458   Gene: ENSPCAG00000000514   Transcript: ENSPCAT00000000488
Sequence length 179
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1003:31831:47649:1 gene:ENSPCAG00000000514 transcript:ENSPCAT00000000488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRLLLILFFWASCVPCIERKVAPAGPSHLKVQCRAFRYPLAVDCSWTQPPAPNSSTST
SFIATYRLGMGPQAKTRLCFQRTPETPSCTIWNFQMFSTVPYVLNVTAIHPGGVSSTLLS
FFPEHIIKPDPPENICLRLTPRKQLQVQWKPPKSWPIPKIFTLKYRIRYKRQGSTYSQQ
Download sequence
Identical sequences ENSPCAP00000000458 ENSPCAP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]