SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000485 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000485
Domain Number 1 Region: 1259-1524
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.0000022
Further Details:      
 
Domain Number 2 Region: 530-792
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-46
Family YWTD domain 0.00000554
Further Details:      
 
Domain Number 3 Region: 1920-2126
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-41
Family YWTD domain 0.0000301
Further Details:      
 
Domain Number 4 Region: 3065-3268
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-32
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 5 Region: 3888-4127
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-19
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 6 Region: 339-451
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-18
Family YWTD domain 0.00048
Further Details:      
 
Domain Number 7 Region: 1173-1251,1525-1569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 3753-3794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000864
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 877-922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 10 Region: 842-881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 11 Region: 2888-2929
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 3467-3507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 13 Region: 2582-2623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 964-1002
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3670-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 16 Region: 2757-2793
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 1049-1087
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 18 Region: 1004-1042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00021
Further Details:      
 
Domain Number 19 Region: 3352-3389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 2184-2339,2385-2452
Classification Level Classification E-value
Superfamily NHL repeat 0.00000000262
Family NHL repeat 0.032
Further Details:      
 
Domain Number 21 Region: 148-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 22 Region: 3507-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 2925-2972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.013
Further Details:      
 
Domain Number 24 Region: 3392-3429
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 2717-2754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 26 Region: 2678-2714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 925-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 2547-2584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 29 Region: 2840-2877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 30 Region: 2966-3001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000369
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 31 Region: 3435-3468
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 32 Region: 3792-3879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 33 Region: 4382-4424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.035
Further Details:      
 
Domain Number 34 Region: 3716-3748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000406
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 35 Region: 798-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000479
Family EGF-type module 0.02
Further Details:      
 
Domain Number 36 Region: 2142-2191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000526
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 37 Region: 1834-1876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.015
Further Details:      
 
Domain Number 38 Region: 1574-1645
Classification Level Classification E-value
Superfamily YWTD domain 0.0000327
Family YWTD domain 0.0036
Further Details:      
 
Domain Number 39 Region: 4211-4247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000485
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000000485
Domain Number - Region: 483-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000272
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 120-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 4284-4318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 2462-2501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0936
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000485   Gene: ENSPCAG00000000335   Transcript: ENSPCAT00000000517
Sequence length 4594
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5695:8088:914624:-1 gene:ENSPCAG00000000335 transcript:ENSPCAT00000000517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFLVALLTLWGLLPVTSVLMVRTDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPEEIEFKCPLNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPNC
QELNCQYKCAIVRNTTRCFCEDGYEVKEDGRSCKDQDECAIYGTCSQTCINTHGSYVCSC
VEGYILQPDNKSCKVKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLINKLVYWVDLYLDYVEVVDYQGKNRHTIIQGRHVRHLYGLT
VFENYLYAISSEHYNVIKINRFNGTDIHSLIKMENARGIWIYQKRAQPTVRSHACEVDPY
GMPGGCSHICLLSTSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDL
NTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTDRETILKDDLDN
VEGISVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGWMY
WTDWEEDETDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIE
KVFLNGTHRKVVYSGKELNHPFGLSHHGNYIFWTDYMNGSIFQLDLVTSEVTLLRRERPP
LFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEI
LPHICKAGEFRCRNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQNNRCIP
KRWLCDGANDCGNNEDESNQTCSARTCQDQFSCGNGRCIPRAWLCDREDDCGDQTDEMAS
CEFPTCEPLTQFVCKSGRCISSKWQCDSDDDCGDGSDEVGCVHSCFENQFRCSSGRCIPG
HWTCDGDNDCGDFSDETQINCTKEEIRSPAGCNGNEFQCHPDGNCIPDLWRCDGEKDCED
GSDEKGCSGTMRLCDHNTKFSCRSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECSLNNGGCSNHCSVVPGRGIVCSCPD
GLQLKKDNKTCELVDYCSSHLRCSQMCEQRKHTVKCSCYEGWKLDVDGESCTNVDPFEAF
IIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESG
GVSAIEVVVEHGLATPEGLTVDWIASNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPR
AIALDPRFGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVW
TDARSDAIYSALYDGTGMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQ
NVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLIGHNTSAACACPHLMK
LSSDKKTCYEMKKFLLYARHSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLY
WTDIKTQTIKRTFINGTGLETVISRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXKLYWTDGNTINMANMDGSNSKILFQNQKEPVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNSCQLNNGGCSQLCLPTSETTRTCVC
TVGYYLQKNRMSCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
DTIYWTDMGFNKISRVKRDQTWKEDIITNGLGRVEGIAIDWISGNIYWTDHGFNLIEVAR
LNGSFRYVVISQGLYQPRSIAVHPEKGYLFWTEWGQMPCIGKARLDGSEKVVLVSMGIAW
PNGVSIDYEENKLYWCDARTDKIERIDLETGGSREMVLSGSNVDMFSVAVFGAYIYWSDR
AHANGSIRMGHKNDATETVTMRTGLGVNLNEVIFNRVREKGTNVCAKDNGGCQQLCLYQG
HSQRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPHYFK
NVIALAFDYNQRRRGTNRIFYSDAHFGNIQLINDNWEDRQVIVENVGSVEGLAYHRAWDT
LYWTSSTTSSITRHTVDQTQPGAFDKEAVITMSEDDHPHVLALDECQNLMFWTNWXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIVK
SGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKVLRSDIPHQPMGIIAVANDTNS
CELSPCALLNGGCHDLCLLTPTGRVNCSCRGDRMLLADNRCVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXNRSCRKGFKPCYNRRCVPHGKLCDGEDDCGDNSD
ELYCKVTTCAAVEFRCADGTCIPRSALCNQNIDCADASDEKNCXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKHKCEENYFGCPSERCILNTWICD
GQTDCEDGFDEFHCDSSCSWNQFACSAQKCISKYWICDGEDDCGDGLDESDSICGAITCA
ADMFTCQGSRGCVPRHWLCDGERDCPNGSDELSTAGCXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXYRQCSAEEFSCADGRCLLNTQWQCDGDFDCPDHSDEAPLNP
KCRSAELSCNSSFFMCKNGRCIPGGGLCDNKDDCGDGSDERNCHINECLSKKVSGCSQDC
QDLPVGYKCKCWPGFQLKDDGRTCVDIDECSSGFPCSQQCVNTYGTYRCFCTDGYEIKSD
NPNGCKSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLNNVIAIDXXXXXXXXXXXXX
XRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPT
ILVSKRLKFPRDLSLHPQAGYLYWIDCCEFPHIGRVGMDGTNQSVVIETKISRPMALTID
YVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHK
TSGADRLSLINSWHAITDIQVYHSYRQPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFKCQPGRF
QCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDC
GDEEDERDCPENSCSPDFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQC
KNNNCIPDHWRCDSQNDCSDNSDEENCKLQTCTLKDFLCANGDCVSSRFWCDGDFDCADG
SDERNCETSCSKDQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGNICRADEFLCNNSLCKLHVWVCDGEDDCGDNSDEAPDMCVTFLCPPTRPHRC
RNNRICLQLEKICNGIDDCGDNSDENHCGDKLTYKAKPCKKDEFACSNKKCIPMDLQCDR
LDDCGDGSDEQGCRITPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCE
DLNECLVFGTCSHQCINMEGSYKCVCDQNFEERNNTCIARGSEDQVLYIANDTDILGFIY
PFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKSIHGRENEANSGLI
CPEFKRPRIAVDWVAXXXXXXXXXXXXXXXXXXTHWTSLRYSVNVGQLNGPNCTRLLTNM
AGEPYAIAVNPKRRMMYWTVIGDHSHIEEAAMDGTRRRILVQKNLQRPTGLAVDQFSERI
YWADFELSVIGSVLYDGSSAVISVSSKQGLLHPHRIDVFEDYIYGAGPKMXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPNPCLDLACEFLCLLNPSGATCVCPEGKYLIN
GTCNDDSLLDDSCKLTCENGGRCILNENGDLRCHCWPSYSGDRCEVNHXXXXXXXXXXXX
XXXXXRPTCSCAQGFTGPNCGKTVCEDFCQNGGSCGVTPGNQPYCLCQPEHTGDRCQYXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTN
GKIASSCQLCDGFCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSKSDHISTRSV
AIIVPLVLLVTLITTLVIGLVLCKRKRRTKIRRQPIINGGINVEIGNPSYNMYEVDHDHS
DGGLLDPSFMIDPTKARYVGRGSSAFKLPPTAPPVYLNSDLKGPLTAAPTNYSNPVYAKL
YMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences ENSPCAP00000000485 ENSPCAP00000000485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]