SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000494 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000494
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.23e-40
Family Pentraxin (pentaxin) 0.0000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000494   Gene: ENSPCAG00000000542   Transcript: ENSPCAT00000000525
Sequence length 224
Comment pep:known_by_projection scaffold:proCap1:scaffold_18276:10432:11211:1 gene:ENSPCAG00000000542 transcript:ENSPCAT00000000525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLLWVSVLITFPEAFVQTNLTGKVFVFPRESSSDHVSLITQMEKPLENLTLCFRAYS
DLSRRYSLFSYSIEGQDNELLIFKDKVGQYSLYIGNVRVTAKVLEQFPAPAHVCTSWESS
TGIAELWVNGKPSVRKGLRQGYSVGVHPKIILGQEQDTYGGGFDKNQSFVGEIGNLYMWD
SVLSEKEILLVYRGFPPNSNIMNWSNLKYEKKGYVIIKPLVWIC
Download sequence
Identical sequences ENSPCAP00000000494 ENSPCAP00000000494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]