SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000522 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000522
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 210-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000314
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 3 Region: 413-450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 123-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 169-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000000522
Domain Number - Region: 325-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00233
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000522   Gene: ENSPCAG00000000573   Transcript: ENSPCAT00000000555
Sequence length 729
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2985:14781:20252:1 gene:ENSPCAG00000000573 transcript:ENSPCAT00000000555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSL
DWLMLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKL
GQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSG
ARSTRCLPVERRCDGAQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLH
CTWLVDTQDPRRVLLQLQLRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQG
RLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDPGDAGDQGCFSEPQRCDGW
WHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPEGADEKNCFSCQPGTFH
CGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFK
LYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQN
LRTAMRRQMRRHASRRGPARRRLGRLWNRLFHRPRAPRGQIPLLTAARASQTVLGNGLLQ
PAPGTAPDPLAPLTDTGSPGAAGDRRPSAPDHTPEGGPSVSLPASGLQDLECRPTDKERK
ACRDALLDRPAPVDMPREPCSPQDPHPLAPTASGTCGAHPPEPLGVCRSPPPPCSPTLEA
SDDEALLVC
Download sequence
Identical sequences ENSPCAP00000000522 ENSPCAP00000000522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]