SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000796 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000796
Domain Number 1 Region: 298-605
Classification Level Classification E-value
Superfamily L domain-like 2.55e-42
Family Ngr ectodomain-like 0.064
Further Details:      
 
Domain Number 2 Region: 57-152,184-262,319-423
Classification Level Classification E-value
Superfamily RNI-like 4.45e-29
Family 28-residue LRR 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000796   Gene: ENSPCAG00000000871   Transcript: ENSPCAT00000000842
Sequence length 680
Comment pep:known_by_projection scaffold:proCap1:scaffold_7413:32246:38762:1 gene:ENSPCAG00000000871 transcript:ENSPCAT00000000842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLSLWLCLGFHFWTVGWRSRSVTATAGAQGGCESVGAVTNCRARHLASVPSDLPPSSQ
TLILDANPLRTLWNHSLQHYPHLESLSLQGCHLECISRGAFREQGHLRSLALADNALSEN
YQETAAAFHLLRDLRSLDLSGNSLTEDMVALMLQNLSSLSVCLARNTVMRLDDSTFEGLG
HLREGAFDGLTELRRLNLAYNNLPCIVDFGLTQLQLLNVSYNDLEWFLASGAETAFELET
LDLSHNQLLFFPLLPQCSKLHTLLLRDNNMGFYKDLYDASSPKEMVAQFLLVDGNVTNIT
TVNLWEEFASSDLSALRFLDMSQNRFQYLPDGFLQKMPSLSHLNLNRNCLMALHIREHDP
LGALTELDLSQNQLSELRWAPGLTGSLQSLQVFNLSSNQLLGIPTGLLADARSITTIDMS
RNQILLCPPPIHLDQVGPPSCVDFRNMASLRSLSLEGCGLGSLQDCSFQGTPLTHLDLSS
NWGILNASITPLWDVAPTLQVLSLRNVGLSSSFMELDFSGFGNLRNLDLSGNSLTSFPRF
GGHLSLQTLDLRRNLLTGLPPKAASEELIRSLQTVYLSQNPYDCCGVEGWGALQHLPMLQ
IPDLAMVTCNLSSKIIHVVDLPSHVPQDCKWERVDMGMLYLVLILPSCLTLLVACTVIFL
TFKKPLLQVIKSRCHWSSIY
Download sequence
Identical sequences ENSPCAP00000000796 ENSPCAP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]