SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000817 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000817
Domain Number 1 Region: 283-533
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.98e-87
Family Eukaryotic proteases 0.000057
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-17
Family Hepsin, N-terminal domain 0.048
Further Details:      
 
Domain Number 3 Region: 154-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000817   Gene: ENSPCAG00000000861   Transcript: ENSPCAT00000000864
Sequence length 538
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4926:3162:32729:-1 gene:ENSPCAG00000000861 transcript:ENSPCAT00000000864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRARGRWPLLILLLKQETGHPKGTQILAALIRSCMREPGKGCVCSEWLIRRSEPSLVLSM
LWGSGHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADAV
AAQILSLLPLKFFPIIVVGIIALILALAIGLGVHFDCSGKYRCRSSFKCIELTARCDGVS
DCKDGEDEYRCVRVSGRLAVLQVFTAAAWKTMCSDDWKGLYANVACGQLGFPSYVSSDHL
RVDLLEEQFQEGFASINHLLSDDKVTALHHSVYVREGCASGHVVTLKCTACGQRTGYASR
IVGGNMSSLMQWPWQVSLQFQRYHLCGSSVITPTWIVTAAHCVYDLYLPKSWTIQVGLVS
LLDSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPLTFNEMVQPVCLPNSEENFPDGK
MCWTSGWGATEDGAGDASPVLNHAAVPLISNKVCNHRDVYGGIISPSMLCAGYLKGGIDS
CQGDSGGPLVCQDRRVWKLVGATSFGIGCAEANKPGVYTRITAFLDWIHEQLERDLKT
Download sequence
Identical sequences ENSPCAP00000000817 ENSPCAP00000000817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]