SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001093 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001093
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily L domain-like 1.56e-29
Family U2A'-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001093   Gene: ENSPCAG00000001183   Transcript: ENSPCAT00000001159
Sequence length 246
Comment pep:novel scaffold:proCap1:scaffold_6672:2816:43292:-1 gene:ENSPCAG00000001183 transcript:ENSPCAT00000001159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKRIHLELRNRTPSDVKELVLDNCRSIEGKIEGLTDEFEELEFLSTINVGLTSVANLPK
LNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFN
CEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEDYDED
AQVVEDEEDEEEEEEGEEEDVSGEEEEDEEGNDGEVDDEEDEEDLGEEERGQKRKRDPEE
EGEDDD
Download sequence
Identical sequences ENSPCAP00000001093 ENSPCAP00000001093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]