SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001292 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001292
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily L domain-like 7.94e-39
Family Ngr ectodomain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001292   Gene: ENSPCAG00000001416   Transcript: ENSPCAT00000001376
Sequence length 314
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4785:406164:417071:-1 gene:ENSPCAG00000001416 transcript:ENSPCAT00000001376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGKLLLLSSAIFLLCGVCSCPEECHCHSETVDCNQRGLATIPSGLPPQTLTLHLQDNQI
HQLPAFAFRSVPRLVTLNLSNNSLSTLAPGAFDGLQHLQVLNLTQNSLHSLENRLFHSLP
QLRELDLSSNNLSHLPRSLGEPWENLTVFAVQQNLLQQLDRALLESMPRVKHLVLKGNLW
KCDCHLLGLKLWLEKFVYKGGRTDGIICVSPDTWKGEDLLTIPHELYPPCPSSLDPAPTW
PPQPGSTHSARLRPSDKHAAEGQDHAECELKPKPRPANLRHAVVTVVITGVVCGIVCLMM
LATIYGCTYAAITA
Download sequence
Identical sequences ENSPCAP00000001292 ENSPCAP00000001292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]