SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001344 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001344
Domain Number 1 Region: 529-660
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-23
Family YWTD domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 26-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 3 Region: 315-392,661-712
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000432
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 197-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 5 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 6 Region: 274-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 7 Region: 139-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.00042
Further Details:      
 
Domain Number 8 Region: 398-458
Classification Level Classification E-value
Superfamily YWTD domain 0.0000107
Family YWTD domain 0.000055
Further Details:      
 
Domain Number 9 Region: 233-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000576
Family LDL receptor-like module 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001344   Gene: ENSPCAG00000001374   Transcript: ENSPCAT00000001429
Sequence length 858
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2926:13853:42826:1 gene:ENSPCAG00000001374 transcript:ENSPCAT00000001429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPGLGLRCAITLLLAAAGAAAADKCERNEFQCQDGKCISYKWVCDGRAECQDGSDESP
ETCMSVTCKSGDFSCGGRINRCISQLWRCDGQVDCENGSDEQDCXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSDEDACPATTCGLANFHIQGSSCIPELWACDGDPECDDGSDEW
PERCGGHNTSAPQSSNGPCSALEFHCGSGECIHMSWRCDDGPDCRDKSDEEGCAVATCRP
DEFQCQDGTCIGSRQCDKEHDCKDSDELGCVNVTLCEGPNKFKCQSGECITLDKVCNSAR
DCRDWSDEPLKECGTNECLDNKGGCSHICNDLKIGYECLCPEGFQLVDQRRCKDIDECQD
PDTCSQICVNFEGGYKCECHEGFQIDPHTKACKAVGTIAYLFFTNRHEVRKMTLDRSEYT
SLIPNLKNVVALDTEVASNRIYWSDLAQRKIYSTEIDKHSVSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMYWTDWGTPAK
IKKGGLNGVDIYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGKNRKTVLED
KKKLAHPFSLAIFEDKVFWTDVFNEAIFSANRLTGSDVNLVAGNLLSPQDLVLFHNLTQP
RGVNWCEKTALHNGGCQYLCLPAPQINLHSPKFTCACPDSMLLARDMRSCVAEAEPAATT
EGSSSIKQMVSSVATERRHVASPPTPSSSGGPVVSLEFTTAEMATMSLQALGDVAGRGTE
NPHRVGALSIVLPVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXRQMVSLEDDVA
Download sequence
Identical sequences ENSPCAP00000001344 ENSPCAP00000001344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]