SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001522 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001522
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.69e-22
Family APC10-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001522   Gene: ENSPCAG00000001652   Transcript: ENSPCAT00000001617
Sequence length 139
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7540:25818:26857:-1 gene:ENSPCAG00000001652 transcript:ENSPCAT00000001617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQSLVCPATVSSVSSVLNRNTRQFGKKHLFDQNEETCWNSDQGPRQWVMLQFPQCVRIS
QLQIQFQGGFSSRRCHLEGSQESQALWGIVDFYPEDNNSLQTFPVPATKVDRLKVTFEDM
SDFFGRVVIYHLRVLGEKI
Download sequence
Identical sequences ENSPCAP00000001522 ENSPCAP00000001522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]