SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001551 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001551
Domain Number 1 Region: 1387-1644
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-52
Family YWTD domain 0.00000355
Further Details:      
 
Domain Number 2 Region: 782-1032
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-51
Family YWTD domain 0.00000224
Further Details:      
 
Domain Number 3 Region: 552-736
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-46
Family YWTD domain 0.00000564
Further Details:      
 
Domain Number 4 Region: 1083-1301
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-38
Family YWTD domain 0.0000064
Further Details:      
 
Domain Number 5 Region: 305-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 269-307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 184-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 8 Region: 109-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 228-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 149-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 11 Region: 737-775,1027-1077
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000118
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 1342-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 13 Region: 350-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 67-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000001551
Domain Number - Region: 1644-1682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001551   Gene: ENSPCAG00000001520   Transcript: ENSPCAT00000001648
Sequence length 1937
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3218:16072:76046:-1 gene:ENSPCAG00000001520 transcript:ENSPCAT00000001648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPWGALLLGALLCAHAPRAGERCRTSRSSSSTRGGSGGGAGPGSGLGRSAGLGRGGSL
ASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFHCD
NGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDGDNDCGDNS
DEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPPCSLEEFQCA
YGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQ
SDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLC
WNGRCIGQRKLCNGVNDCGDNSDSPQQCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAIAL
HPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGHRMYWVDAKHHV
IERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKL
HFPMDIHTLHPQRQPPGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHTCAQSLD
KFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAK
WDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRP
RDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWAD
AGMKTIEFAGLVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLE
NLMDIHVFHRRRPPVSTPCSLENGGCSHLCLRSPNPSGFSCTCPTGINLLSDGKTCSSGM
NSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISR
ASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLD
SPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLW
ADAHTERIEAADLNGASRHTLVPVQHPYGLTLLDSYFYWXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDAKTC
DPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDV
IXXXXXXXSNMETVIVRGMKTIDGLAVDWLARNLYWTDTGRNTIEASRLGGSSRKVLINN
SLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRR
IYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGR
NKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARAVDFVCACPDEPDGRPC
SLVPGMVPPAPRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSEKDAQLGLCA
HSNEAIPAAPGEGLHVSYVIGGLLSILLILLVIAALMLYRHKKSKFTDHGMGNLTYSNPS
YRTSTQEVKIEAVPKPTMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQ
LRSSRGGLLRDHVCMKTDTVSIQASTGSLDDMETEQLLQEEQSECSSVHTATTPERRGSL
PDTGWKHERKLSSESQV
Download sequence
Identical sequences ENSPCAP00000001551 ENSPCAP00000001551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]