SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001667 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001667
Domain Number 1 Region: 63-203
Classification Level Classification E-value
Superfamily L domain-like 5.83e-34
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 255-525
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000127
Family Soluble quinoprotein glucose dehydrogenase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001667   Gene: ENSPCAG00000001791   Transcript: ENSPCAT00000001773
Sequence length 548
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4878:87968:95001:-1 gene:ENSPCAG00000001791 transcript:ENSPCAT00000001773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLRARRGPGPGLLALSTLGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPR
NLPSEIISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIE
NNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNSLNCDCKVKW
LVEWLAHTNTTVAPIYCNSPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFL
YSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLF
GGSYIYHWDPNTTRFNKLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWH
QNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQSEVTQV
PDAQAVKHFRAGRDSYLCVSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRY
LALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYR
HVVVDLSA
Download sequence
Identical sequences ENSPCAP00000001667 ENSPCAP00000001667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]