SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001723 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001723
Domain Number 1 Region: 235-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-85
Family Eukaryotic proteases 0.0000867
Further Details:      
 
Domain Number 2 Region: 139-241
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000235
Family Scavenger receptor cysteine-rich (SRCR) domain 0.059
Further Details:      
 
Domain Number 3 Region: 107-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000011
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001723   Gene: ENSPCAG00000001830   Transcript: ENSPCAT00000001832
Sequence length 485
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6653:5163:33545:-1 gene:ENSPCAG00000001830 transcript:ENSPCAT00000001832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPPGAGPYYENHGYQPENFYPLQPSGTPGVNPAYPHQYYPPSVPQYIPRVLTQASTPVI
LRQPKPRRGTVCTSKAKKVLCVTFTLGTILAGVVLAAVLLWRFLDNCSSGIECGSSGICV
SSSNWCDGISHCPGGEDENRCVRLYGPNFILQVYSAQRRSWHPVCWDDWSDNYGRAACRD
VGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDACSSKMVVSLRCIECGVT
TKVTLQSRIVGGDSAALGEWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSNPRY
WTAFAGILRQSSMYYEKQYQVEKVISHPNYDPKTKNNDVALMKLQTPLTFNDRIRPVCLP
NPGMMLELTQACWISGWGSTQPKGKISDVLNAAKVHLIEPRICNSRYVYNNLVTPAMICA
GYLQGTVDSCQGDSGGPLVTFKNSIWWLIGDTSWGSGCAMENRPGVYGNMTVFTDWIYRQ
MRASS
Download sequence
Identical sequences ENSPCAP00000001723 ENSPCAP00000001723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]