SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001750 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001750
Domain Number 1 Region: 102-207,253-295
Classification Level Classification E-value
Superfamily L domain-like 0.00000000612
Family mRNA export factor tap 0.074
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000001750
Domain Number - Region: 652-695
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0254
Family Rubredoxin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001750   Gene: ENSPCAG00000001794   Transcript: ENSPCAT00000001860
Sequence length 1018
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_641:88310:105441:1 gene:ENSPCAG00000001794 transcript:ENSPCAT00000001860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTVPRDSLVCQLAGLLRQSGDVVLSGCSTLSLLTTTLQQLNHVFELHLGPWSPGQTGFV
ALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVPGPGPPGPIKIFPFKSLRQLELRGVPL
YCLRGLRGIYSQLETLICSRSIQALEELLSACGGDLCSALPWLALLFANFSYNSLTALDS
SLRLLSAVRFLNLSHNHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXVEQLRNLRHLDVAYNLLEGHGELSPLWLLAELHKLYLEGNPLWFHPAHRAT
TAQYLSPRARDAASGFLLDGEVLSFTDFQTSTSSGLGSVAPPVPWPAGSTTETSGGPDLS
DSLSESLPGRPPHRRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFAQQHRELELMNS
FRERFGCDWLQYRSHLETSENPHLAISKPLDFSTGPPDAGPRTAAWPPSEEVGSPAESVQ
EALEEIRVGLEPQEEEETEELEEEKRKEDQEEEEEQEQNEVEAELCRPMLVPLQGEGVRG
RERFLRVTSGHLFEVELQAGRILERLELQSLEAAEIEPATPAQRERAPGDNEPLPPILHF
SYICLDRQLRRYLVLEPDARAAAQELLAVLTSATATARHQLDESRDPRGSRLQCLRCGHE
FKPEEPRLGLDSEDGRKPLFWKPDSPAVCPNCGSDHVVLLALSPTSERRQGEQSPALCLS
RSPVCESSGHSDAHNRADSVPFEALPSQNHSRWSLSPPPDRCGLRTVDHRLRLFLDVEVF
SDAQEEFQCCLKVPLVLTGHTGEFLCLVVVSDRRFYVLKVMGEICGPPAGWLQPILAIPL
QDLSGIELGLAGQSLRLEWAAGGGSCVLLPRDAEHCRAFLGELTDVLQSLPPTWKNCVSA
TEEVVTPQHRLWPLLDTGSSLEAPCFFYLRVFLVEGPSPCPVSLLLTWSTLYLLDENPAG
PQVEPLPPAGAGEASEKAPPLGPGPSVGVRERQPLSSLSSVMLYRVAPKDLRLIFYDE
Download sequence
Identical sequences ENSPCAP00000001750 ENSPCAP00000001750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]