SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001891 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001891
Domain Number 1 Region: 1405-1654
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-47
Family YWTD domain 0.0000068
Further Details:      
 
Domain Number 2 Region: 350-613
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-44
Family YWTD domain 0.000008
Further Details:      
 
Domain Number 3 Region: 2344-2599
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-42
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 1702-1967
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-40
Family YWTD domain 0.0000667
Further Details:      
 
Domain Number 5 Region: 666-916
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-34
Family YWTD domain 0.0000253
Further Details:      
 
Domain Number 6 Region: 2076-2289
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-30
Family YWTD domain 0.0000857
Further Details:      
 
Domain Number 7 Region: 3158-3290
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-17
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 8 Region: 4021-4180,4224-4272
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-16
Family YWTD domain 0.00031
Further Details:      
 
Domain Number 9 Region: 1221-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000602
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 10 Region: 1021-1059
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 3101-3149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000126
Family EGF-type module 0.005
Further Details:      
 
Domain Number 12 Region: 1061-1099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 13 Region: 3583-3623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 14 Region: 2688-2729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000102
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 1103-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000118
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 16 Region: 2942-2985
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 2814-2853
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 18 Region: 2983-3025
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 2860-2896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 20 Region: 978-1016
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 3675-3712
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 22 Region: 3750-3789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 3031-3073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 3883-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 26-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3504-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 65-118,148-244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000487
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 28 Region: 181-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000005
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 29 Region: 1141-1179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 30 Region: 1309-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000008
Family EGF-type module 0.008
Further Details:      
 
Domain Number 31 Region: 3471-3503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 32 Region: 3798-3836
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 3711-3750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 3543-3583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 1182-1219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 36 Region: 3350-3420
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000419
Family YWTD domain 0.0013
Further Details:      
 
Domain Number 37 Region: 2652-2696
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 38 Region: 1338-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000963
Family EGF-type module 0.011
Further Details:      
 
Domain Number 39 Region: 2770-2816
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 2900-2944
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 41 Region: 3839-3877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 42 Region: 1974-2021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.027
Further Details:      
 
Domain Number 43 Region: 107-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000132
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 44 Region: 1266-1302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 45 Region: 3638-3671
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 46 Region: 2732-2774
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000641
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 47 Region: 3068-3107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000943
Family EGF-type module 0.011
Further Details:      
 
Domain Number 48 Region: 3965-3996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000948
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 49 Region: 617-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000001891
Domain Number - Region: 2295-2338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000121
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 1655-1698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000395
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 936-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000605
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 307-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 3425-3486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00439
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 4282-4365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 2607-2668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001891   Gene: ENSPCAG00000001758   Transcript: ENSPCAT00000002010
Sequence length 4607
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_667:65485:236785:-1 gene:ENSPCAG00000001758 transcript:ENSPCAT00000002010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPTATAAFALLLALATCLVSANGQECSSPESRCSSGHCIPLSWLCDGNYDCVGDSDEA
ACPETTCSSHQITCSDGQCIPRQYRCDHVKDCSDETDERYCHYPQCEQLTCANGACYNTS
QKCDGKLDCRDNSDEVNCTNVCDRTDFQCNNGECIPHSFVCDRKNDCGDNSDEPQSCVYR
DCGSREFTCPNGRCIYHTWVCDGDNDCGDNGDEDGCESSKYRECYPREWACPESGQCIPI
DKLCDGTPDCPAGEDETNTTAGRYCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFDDCQIWGICAQMCEDRSGYHHCRCAEGYILEEQRQCKASSGTAYVVFSNGRDL
LVGDIHGRNFRTLVESQNRGVVVGVDFHYDLHKFFWTDVAQHKVFSIDMDSFNTQEVLNV
SVDAAENLAVDWINNKLYVVETKVNRIDLVNLDGSDRVTLITENLGHPRGVAVDPTVGYL
FFSDWESLSGEPALERAFMDGSARRNLVTSKLGWPAGVTLDFVSKRVYWVDPRFDYIETV
TYDGLQRKTVVHGGSLVPHPYGISLFEEQLFFTDWTKMAVMKANKFTETNPQVYYQSSLR
PYGVTVCHSVRQPKVENPCGNNNGGCEQICVLSHVLDNDGLGYRCKCSHHFELADDDHHC
VAVKKFLLFSSQEAIRGISPSRTFQEDVIVPVTRSHSSFVGVDYWAQEKTIFFSDMSQDM
ICRQNIDGTGREILTANRVENVEGLTFDWLSKNLYWTDAGYRSISVMRLADKSRREIVKN
LNNPRAIVVHPIMGYIFWTDWFRPAKIMRAWSDGSHALPIVNTTLGWPNGLAIDWSASRL
YWVDAFFDKIEYSSFDGLGRGTLGNIEQMTTPFGLTILGXXXXXXXXXXXXXXXVRKMDG
RVLLVLRKGISNIRHVKSYDADAQTGSNYCSQSTYPNGDCSHFCFPVPNFERVCGCPYGM
SLSSNHLTCVEDQTREPPMAQCGLYSFPCNNSRCVPSYYQCDGVDDCQDNSDEEHCGTSN
NTCAASAFTCGNGQCIPAVWHCDKLNDCGDGSDEQNCPTRMPASCTADEFTCDNNLCIPR
SWVCDTDNDCGDGSDEKNCESTETCHVSQFQCPNHRCIDLSFVCDGDKDCVDGSDEADCL
FNCTASQFTCASGDHCIPIGNLCDGVFDCQDHSDERGCPTRPPGMCHRDEFQCQADGSCI
PKLWECDGHSDCIEGSDEHPGCPPRTCPLTNFRCDNGFCIPKTWLCDGDNDCRDMSDERD
CKPEAFHCPSHQWQCPGLSVCVDLSAVCDSVSDCPNGADESPVCNQDSCLEDNAGCTHEC
YQGPFGAQCSCPLGFQLANDTKTCEDINECDIPGFCSQHCHNMRGSFRCWCDAGYILVGD
GKTCRAQAPDSLLLLVASQNKIVADIITSETQDVYLLVQNGSHIVAIDFDSVTGRIYWSD
VTQDKIWSAFQNGTDRKVVLDSGISMTESIAIDWVGRNLYWTDYALETIEVCKLDGSHRT
VLISENITNPRGLALDPRIDDHLLFWSDWGTHPRVERASMDGSMRTVIVRDKIYWPTGLT
IDYTNRLIYFSDAYLDYIDYCDYNGDHRRQVIASDLILQHPYGITLFEDAVYWTDRTARV
MHANKWHGGNQSIVMYNIPQPLGIAAVHPVKQPPSVNSCASSPCSHLCLLSSQGPNFYSC
MCPSGWRLSHDTVNCVQDEKPFLITVRQHVILGISLNPELRSNDAMVPIAGLQNGHDVDF
DDTEQYIYWVEHPGEIHRVKTDGTNRTVFVPAFTLGFPESLALDWISRNLYYTNPGTQSI
EVLTLKGDHKYRKTLITNDGTAAGVGYPIAITVDPARGKLYWTDQGTDSGVPAKIASANM
DGTFPQILFTGNLDHLESITLDIKEQKLYWAVTSTGVIERGNVDGTNRMILVYHLSHPWG
IAVYDAFLYYADNDYEVIERVDKATGANKVVLRDNVPTLRCLRVYHRRDSAGSSNGCSNN
MNACQQICLPVPGGLFSCACATGFKINPDNRTCTQYSSFIVVSTLSAIKGFSLDLSDHSE
AMMPVAGPXXXXXXXXXXXXXXXXXXXXFNSSVPSQNAIRRIKPDGSHLTDIVTGIGQNG
ARGIAVDWVAGNLYFTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRDIVVDPKNRYLFW
ADYGQRPKIERAFFDCTNRTVLVSEGIVRPRGLAVDHYSSYIYWVDDALDVITRTHIITG
ESEVIRIGSRYPTPYGITVFGNSIIWVDRNLKKIFQASKEPGNTEPPTVIRDNLNWLRDV
TMFDQQVQPRSPVEINNNPCMENNGGCSHLCFALPGLQTPKCGCAFGMLDGDGKSCALST
ENVLIFALENSLRSLQLNPDNHNPPFQAIDVKGTVVALDYDSINDRIYFTQNSNSGRGQI
SYISLHSRDSSTVIVSDTGSADGIAFDWINNRIYYSDYVNQTITSVAIDGSNGTVIARVL
RPRGIVLDPCRGYVYWTDWSTNAKIERATLAGNFRVSIVNNSLVWPNGLTLDYKEELLYW
ADASLQRIERSSLTGMNREVVVSTTLNPFALTLYSEYIYWTDWYTKSVYRANKYDGSGQI
VMITNLPTRPMGIRITGKSEQHQCSNPCSQFNGGCSHICAPGPNGAECQCPAEGRWYLAN
NNKHCIVDTGTRCAANEFTCFSGHCIPAEGKCNLEVSCSDGSDELESVCAFHTCPSTSFT
CTNRLCISYHFRCDFYNDCGDNSDEMGCVFRPCNTSTEFSCTNGRCISLQYVCNGISNCH
DGGPGNVSSDELHCPDITCRPGYTKCENANVCIPRSYLCDGDYDCVDMSDENPTYCCART
CSSTQFLCASGNCIPSAWYCDGDQDCHDGSDEPASCEHHLPTCTSEQFRCDGGRCISSSW
ICDGQDDCGDMSDEDKRHNCENYICASHEFLCVNSGPSSMRCIPESWVCDGDADCSDAYD
EHQNCTRRTCSGNEFTCSNGLCIGNLFRCDWTNDCGDYSDERNCMYPPCLDHQFTCQNGR
CIPKDFFCDGVNDCEDDSDELEHLCQTAEPTCPPHGFKCDNGNCIEIAKVCNHVDDCTDR
SDERGCGINECNYPSISGCDQNCTDTQTSFYCSCHPGYKLMSDKRTCDDIDECKETPSVC
SQKCENTLGSYICKCAPGYFREPDGKSCRQNSNITPELIFSNRYYVRKLSTDGEDYSLFL
QGLGNVVALDFDQVENRLYWSDLERKVIERKFLNMTDRETVLNRDLPAVQGLAVDWVTRK
LYWLDAELDGLFVSDLNGRFRRKLAEHCVDVNNTFCFENPRGIVLHPQYGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSDLEGHHRHRVY
DGTLPHPFAITIFEDTVYWTDWNTKSVEKGNKYDGSNRKLLVTLTHRPFDIHVYHPYRQP
IVDNPCGVNNGGCSHLCLIKAGGHGFTCECPDHFVTIRLRGSTHCLPMFSSTQFLCADNE
RCIPIWWKCDGQRDCADGSDEPDICPERRCRLGEFQCKNGNCTSSHALCNAHQDCPDGSD
EDPILCANHQCASNEWQCANKRCIPESRRCDSHDDCSDNSDEDISHCATRTCLPGQFKCD
NGRCIPRSWKCDYDNDCGDYSDEPLQECMGPAYRCDNHTAFSCKTNYRCTPKWNLCDGVD
DCRDNSDEEGCEEMTCNPVGDFRCNNHRCIPLRWRCDGRNDCEDNSDEDGCVPRECSESE
FRCDNQHCIPSRKICDHNNDCEDNSDERDCEMKTCLPGYFRCGTGHCVPGNMKCNGIADC
LDASDEAICPTRFPSGAHCPDTMFECKNHVCVQPRWKCDGEDDCGDGSDEELHLCFTVPC
DSASRFRCDNNRCIYKNKLCNNVDDCGDKSDEKEENCRAPTPGTCMEDQFKCGSGHCIPE
LYVCDDIDDCGDHFDEMGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIDECEDFGTCPQECHNTKGSYECACADGFKSMGEPYGKRCAADGDPPLLLLPDNVR
IRKYNISSQKFSDYLEDERIQADYDWDPXXXXXXVVYYSVLGEGSDFGCIKRAYIPNFET
GGNNPVQVVDLNLKYIVQPNGLAVDWIGRHIYWSDARTKRIEVAKLDGRYRKWLISTLLN
QPAAIVVNPKLGLMYWTDWGSESKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXWNPNSLDIFEGQIYWTSKEKGGVWKEDKFGNGNR
VKVLTVSPWLTQVRIFHQHRYNQSVPNPCKDVCSHLCLLRPGGYTCACPQGTSFLQGSAT
ECDAXXXXXXXXXXXCRCMYGGCYFDENNLPKCKCPSGYTGSYCEIGFSRGIPPGTTAVA
ALLTVIFIIIIGALAAGGFFHYRKTGSLLPSLPKLPSLSSLVKSSENGNGVTFRSGMDVT
MDIGVSGFGPESAIDRSMAMSEHFAMEPGKQPIIFENPMYSSRDNTVTVIQPTQVAESGS
GMTKNYESPTSPPEIAPETKETAPSASGTQATKWNFFKRKLKQMTNFENPIYAEMETEQK
DRTTEAPPPSPTLPAEISLEREPTPSYTATEDSFKDTVNLVREDSDV
Download sequence
Identical sequences ENSPCAP00000001891 ENSPCAP00000001891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]