SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001915 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001915
Domain Number 1 Region: 38-151
Classification Level Classification E-value
Superfamily L domain-like 5.61e-22
Family Internalin LRR domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001915   Gene: ENSPCAG00000002042   Transcript: ENSPCAT00000002035
Sequence length 321
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_51:30737:34910:1 gene:ENSPCAG00000002042 transcript:ENSPCAT00000002035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAELAANPEKGGICITEALITKRNLTFPEDDDLSEKMFHTLAELQTVRLDREGITFIK
NLDSLQNIHSLYLQSNKIQKIENLACIPSLRFLSLAGNRIQQVENLLDLPHLQFLDLSDN
LIETLKLDEFPHSLLILNLTGNSCTKQKGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXFLKDLEQEITRHRERREQTALMEHLLRMETQLTLTDLPLRP
EEPMAGDSNPPAPPKQKKKAPPKSVASPQKYSATKMPCPLTSLGPKGAAQAQEGARAGAV
PKTSLTGVPRATKTMTKKSKN
Download sequence
Identical sequences ENSPCAP00000001915 ENSPCAP00000001915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]