SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002047 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002047
Domain Number 1 Region: 533-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 194-237,297-373
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-16
Family I set domains 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000002047
Domain Number - Region: 67-169
Classification Level Classification E-value
Superfamily L domain-like 0.000106
Family Ngr ectodomain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002047   Gene: ENSPCAG00000002142   Transcript: ENSPCAT00000002175
Sequence length 838
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4229:19966:222862:1 gene:ENSPCAG00000002142 transcript:ENSPCAT00000002175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWTRWHGPAMARFWGFCWLVVGFWRAALACPTSCTCSASRIWCTDPSPGIVAFPRLEP
NSAEPDNITEIYIANQKRLEVINEDDIEAYVGLKNLTIVDSGLKFVAHKAFLKNSNLQHX
XXXXXXXXXXXXXXXXXXXXXXXILVGNPFTCSCEIMWIKTLQEMKSSPETQDLYCLNEN
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANLNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVADKAGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences ENSPCAP00000002047 ENSPCAP00000002047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]