SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002397 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002397
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily L domain-like 3.74e-17
Family Ngr ectodomain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002397   Gene: ENSPCAG00000002571   Transcript: ENSPCAT00000002540
Sequence length 272
Comment pep:known_by_projection scaffold:proCap1:scaffold_3131:78082:88676:-1 gene:ENSPCAG00000002571 transcript:ENSPCAT00000002540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALPKATILDLSCNKLTTLPSEFCGLTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNN
RLVTLPVSFAQLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCANKVLQHMKAVQADQ
ERERQRRLEVEREVEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKATKREQEK
KPKKETNQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFCVAGGLVACRVTELRQHP
LCTSVNTIYDNALQGLRSHEILRWVLQTDSQQ
Download sequence
Identical sequences ENSPCAP00000002397 ENSPCAP00000002397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]