SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002654 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002654
Domain Number 1 Region: 3-296
Classification Level Classification E-value
Superfamily L domain-like 6.23e-57
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 2 Region: 340-434
Classification Level Classification E-value
Superfamily Immunoglobulin 7.79e-18
Family I set domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000002654
Domain Number - Region: 444-534
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00937
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002654   Gene: ENSPCAG00000002858   Transcript: ENSPCAT00000002818
Sequence length 626
Comment pep:known_by_projection scaffold:proCap1:scaffold_96698:5826:7706:-1 gene:ENSPCAG00000002858 transcript:ENSPCAT00000002818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELSYLANLTELDLSQNSFSDARDCDFLALPQLLSLHLEENQLTRLEDHSFTGLSSLQEL
YLNHNQLYRIAPRAFAGLSNLLRLHLNSNLLRAIDSRWFEMLPSLEILMIGGNKVDAILD
MNFRPLASLRSLVLAGMNLREISDYALEGLQNLESLSFYDNQLVCVPRRALEQVPGLKFL
DLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFI
HPHAFHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANSTDTR
VRFIEPQSTLCAEPPDLQRRPVREVPFREMTDHCLPLISPRSFPASLQVVSGESLVLHCR
ALAEPEPEIYWVTPAGVRLTAPRAGRRYRVYPEGTLELRRVTVEEAGLYTCVAQNLVGAD
TKTVNIVVGRAPLQPGRDEGWGLELRVQETHPYHILLAWVPLPNTVSTNLTWSSTSTLLG
QGPTSVARLPRGTHSYNITRLLQATEYWACLQVAFADAHTQLACVWARTKEATPCLRALG
DRPGLIAILALAILLLAAGLVAYLGTHQPRQEVDRRPLFPAWAFWGWSGPSVRIVSAPVV
LPWSPGRKLLRSSEGETLLLPLSQKS
Download sequence
Identical sequences ENSPCAP00000002654 ENSPCAP00000002654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]