SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002701 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002701
Domain Number 1 Region: 24-334
Classification Level Classification E-value
Superfamily L domain-like 3.4e-54
Family Ngr ectodomain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002701   Gene: ENSPCAG00000002919   Transcript: ENSPCAT00000002871
Sequence length 468
Comment pep:known_by_projection scaffold:proCap1:scaffold_107824:238:1644:-1 gene:ENSPCAG00000002919 transcript:ENSPCAT00000002871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGLPGTWATGTCVRTCPTACVCSSSERGCSVRCDRAGLLRVPAEFPCEAASIDLDRNG
LRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLSGLAELRLAHNGDLRYLHARTFAA
LGRLRRLDLASCRLFSVPERLLAELPALRELAAFDNLFRRVPGALRGLANLTHAHLERGR
IEAVASSSLQGLWSLRSLSLQSNHVRTVQAGAFRDCGFLEHLLLNDNLLAVLPADAFRGL
RHLRTLNLGGNALGRVERSWFTDLAELELLYLDRNSIAFVEEGAFQNLSGLLALHLNSNH
LTALAWAAFQPGFFLGHLFLFRNPWHCDCHLQWLRVWMESSGHAADMLCTSPGSVAGLDL
SQVAFGRSSDGLCVDPMELNLTVTSPGPSPEPAATTVSRFSSLLSKLLAPRAPVEMADNT
TEVLANTSFSSSLPSHGVEHWGCKVMILLSSYLLLTVVQYAVFGLHVD
Download sequence
Identical sequences ENSPCAP00000002701 ENSPCAP00000002701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]