SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002768 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002768
Domain Number 1 Region: 299-451
Classification Level Classification E-value
Superfamily L domain-like 3.23e-16
Family Ngr ectodomain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002768   Gene: ENSPCAG00000002949   Transcript: ENSPCAT00000002942
Sequence length 485
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6139:480:51576:1 gene:ENSPCAG00000002949 transcript:ENSPCAT00000002942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTIETKPPDAKITQDETTPTKEDTTIIPDTTSRKQLQTLLSVQTLFFDYRTQEKVTFLRP
IHTAHDTCFENVCLNIPDNAHGSVFFPRCRSASARVFRKEIRQIESLRKSKTIKNYYVDA
KFKDMLILTSEFSKALSTPVPLTTSTVVFLEHPPKSMGHPPESMGRPPESTVIELRTAVL
SPLPSVMSPKPEKQWSQLTTTTPKVLAIREFPGALSIPPPVLPRKPARQSSLENLVAENE
NANAEVVQKQKAPTMSQGLIRTKRKDKVKKSVVRGEGFKTVSATQYETVMAMTNLAILNC
QIHGRNALNLKGFFILKCPDLTPLAFQLIYLNLSYNDISCFPSEVFCLKNLQILILRSNP
IKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFALSHLEELDVSYNDISSIPDEIKQLRSL
EKLNVDGNDLTSFPPAILKLNLKKIQFENNYTHPQLWKENSLNSPQRLTHLVAFFFLKNE
LHRFH
Download sequence
Identical sequences ENSPCAP00000002768 ENSPCAP00000002768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]