SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002947 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002947
Domain Number 1 Region: 668-971
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.41e-76
Family Myeloperoxidase-like 0.00000291
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily L domain-like 3.06e-29
Family Internalin LRR domain 0.089
Further Details:      
 
Domain Number 3 Region: 275-369
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-28
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 359-454
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-25
Family I set domains 0.0078
Further Details:      
 
Domain Number 5 Region: 460-546
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-22
Family I set domains 0.039
Further Details:      
 
Domain Number 6 Region: 1176-1241
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.77e-16
Family Myeloperoxidase-like 0.0011
Further Details:      
 
Domain Number 7 Region: 1342-1399
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000471
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 217-273
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000118
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002947   Gene: ENSPCAG00000003083   Transcript: ENSPCAT00000003139
Sequence length 1406
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2950:26818:87476:-1 gene:ENSPCAG00000003083 transcript:ENSPCAT00000003139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKKIPSGSFEDLENLKYLYLYKNEIQSIDR
QAFKGLASLEQLYLHFNQIETLDPESFQYLPKLERLFLHNNRITHXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNELSMKTDSRLNLLDDGTLMIQNT
QETDQGIYQCMAKNVAGEVKTQEVTLRYFESPARPTFVIQPQNTEVLVGESVTLECSATG
HPQPRITWTKGDRTPLPPDPRVNITPSGGLYIQNVIQEDSGEYTCFASNSVDSIHATAHI
IVQALPQFTVTPQDRTVIEGQTVDFQCEAKGYPQPVIAWTKGGSQLSVDRRHLVLSSGTL
RISGVALHDQGQYECQAVNIVGSQRVVAHLMVQPRVTPVFASIPSDMTVEAGTNVQIPCS
SQGEPEPVITWNKDGVQVTESGKFHINPEGFLTINDVGTADAGRYECVARNTIGYASVSM
VLSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHYNDLVSPQYLNLIANLSGCTAHR
RVNDCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPNRLY
NGHVLPMPRLVSTALIGTETITPDEQFTHMTMQWGQFLDHDLDSTVVALSQARFSDGQHC
SSVCSNDPPCFSVMIPPNDPRGMDGARCMFFVRCIVCGFGMTSLLMNSVYPREHIPHLTS
YFDASNMYGSTDHEAREIRDLASHRGLLKHVILFASDFALLPFATGISTDCMRDENESPI
PCFLPGDRQSLNELVLSMHFLWFREHNRVATELLKLNPHWNGDTIYYDTNIVPSEILDII
YQHWLRKMLEVFTIMGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWYENPGVFSPAQLTQIKQTSLARI
LCDNSDNITRVQKDVFRRAEFPHGYSNCEEIPKVDLRVWQDCCEDCRTRGQFNAFSYHFR
GKRSLEFSYQEDKPTKKTRPRKILSVVKHNQYVSNATSTSYEHANVPGTNDFKEFVLEMQ
KTITDLRKQIKKLESRLSKTECTDAKGESHTNNAKWKKDSCTVCECKDGQITCLVESCQP
AECPTPVRVKGACCPVCLKKDMEKKP
Download sequence
Identical sequences ENSPCAP00000002947 ENSPCAP00000002947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]