SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003271 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003271
Domain Number 1 Region: 7-244
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000143
Family Internalin LRR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003271   Gene: ENSPCAG00000003519   Transcript: ENSPCAT00000003486
Sequence length 274
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4595:1070:14690:1 gene:ENSPCAG00000003519 transcript:ENSPCAT00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLNLPSVLVLNSCGISCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPHLEFL
NLSSNPLYLSVLERTCAGSFSVVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYET
VSCPSICCHSLKLLHITDNNLQDWTEILKMVGVMFPSLDTLVLANXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLHSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSV
SKLNGSVVTDCEREDSERFFIRYYVDVPQEEVPF
Download sequence
Identical sequences ENSPCAP00000003271 ENSPCAP00000003271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]