SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003436 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPCAP00000003436
Domain Number - Region: 184-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0468
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003436   Gene: ENSPCAG00000003687   Transcript: ENSPCAT00000003663
Sequence length 265
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7347:144693:148429:-1 gene:ENSPCAG00000003687 transcript:ENSPCAT00000003663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENFSFLSISGPRIRSSAMSTFPDIMSSRATSLPDITKTAVSAEASSPAQALPSQHQSNA
LHQHRVHNRMLTPDYTTGDTQNGEQLRRNCTIYRPWFSPYSYFVCTNKESHLEAYSFPEV
QRDEGRGDNCLPEDIAESVCSSSSSPENTCPREVTKKSRHGLDSMDYITSQDILMASKWH
PAQQNGYKCAACCRMYPTLHSLKSHIKGGFKEGFSCKVYYRKLKTLWDKEQKARLGDRLA
SGICQAFNSPAGHLRYIDEAYLCLW
Download sequence
Identical sequences ENSPCAP00000003436 ENSPCAP00000003436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]