SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003533 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003533
Domain Number 1 Region: 156-261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-21
Family MAM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000427
Family Glycosyl hydrolases family 16 0.075
Further Details:      
 
Domain Number 3 Region: 88-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003533   Gene: ENSPCAG00000003795   Transcript: ENSPCAT00000003764
Sequence length 262
Comment pep:novel scaffold:proCap1:scaffold_124687:865:5761:1 gene:ENSPCAG00000003795 transcript:ENSPCAT00000003764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYNYGLSVGAAELQLHVGGSNDSTVLWRVLYNQGNQWSEVTIQLGRLTEPFHLSLYKASF
SIYDGISAIDDIRFENCSLPLPAESCEGPDHFWCRYTKACIEKFRLCDLVDDCGDRTDEG
DCXXXXXXXXXXXXXXXXXXXXXXXXXXXNKGPTATLNTGPMKDNSLGTAKGHYLYIESS
EPQEFQNRAALLSPVLNATNKKSCTFRLYYHMFGKHIYRLAIYQRIWSNTRGQLLWQIFG
NQGNRWIRKCLNISSTHPFQVP
Download sequence
Identical sequences ENSPCAP00000003533 ENSPCAP00000003533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]