SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003585 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003585
Domain Number 1 Region: 728-830
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.94e-29
Family Protein kinases, catalytic subunit 0.0000545
Further Details:      
 
Domain Number 2 Region: 514-633
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-25
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000163
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000144
Family I set domains 0.000018
Further Details:      
 
Domain Number 5 Region: 78-191
Classification Level Classification E-value
Superfamily L domain-like 0.00000136
Family Ngr ectodomain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003585   Gene: ENSPCAG00000003785   Transcript: ENSPCAT00000003819
Sequence length 839
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3712:49977:430570:-1 gene:ENSPCAG00000003785 transcript:ENSPCAT00000003819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSRLRSIQP
RAFAKNPHLRYXXXXXXXXXXXXXXXXXXXXXXXXRLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCISADGSQLPLSRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKITHVEYYQEGEVSE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFVPFVEVSPTPPIT
VTHKTEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKXXXXXXLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Download sequence
Identical sequences ENSPCAP00000003585 ENSPCAP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]